PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000566760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 528aa    MW: 59581.3 Da    PI: 9.0392
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000566760genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA36.56.5e-12113144132
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrk 32 
                    C++Cgt kT+ W  gp g+ktLCnaC+  y++
  MDP0000566760 113 CHHCGTRKTSRWQAGPLGPKTLCNACWCWYKS 144
                    ***************************99986 PP

2GATA38.61.5e-12151181133
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkk 33 
                    C++Cgt +Tp+WRr   g  tLCnaC ++ +++
  MDP0000566760 151 CQHCGTLNTPQWRR--VGRDTLCNACAIKLKHR 181
                    *************6..56899*******99976 PP

3GATA30.64.7e-10189222132
           GATA   1 CsnCgttk.TplWRrgp.dgnktLCnaCGlyyrk 32 
                    C+ C t+k Tp+WR++   g+k LC aC ++y++
  MDP0000566760 189 CQDCETKKsTPQWREDCpKGKKALCDACYVRYKS 222
                    ***************955**************97 PP

4GATA32.98.8e-11264294434
           GATA   4 CgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                    Cgt ++  WR gp g+ tLC  CGl+y++ +
  MDP0000566760 264 CGTGNSLRWRAGPLGTNTLCDNCGLRYKSGR 294
                    ****************************987 PP

5GATA34.23.6e-11340370131
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyr 31 
                    C++C t   p WR+gp g  tLCnaC+ +y 
  MDP0000566760 340 CQQCETEAXPKWRSGPXGLXTLCNACWHRYE 370
                    ***************************9995 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF577164.13E-8105144No hitNo description
Gene3DG3DSA:3.30.50.104.0E-8106144IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011410.027107143IPR000679Zinc finger, GATA-type
SMARTSM004018.4E-5107150IPR000679Zinc finger, GATA-type
CDDcd002021.19E-7112144No hitNo description
PfamPF003209.5E-10113144IPR000679Zinc finger, GATA-type
PROSITE profilePS5011410.936145182IPR000679Zinc finger, GATA-type
SuperFamilySSF577162.9E-7148181No hitNo description
CDDcd002022.95E-7150181No hitNo description
Gene3DG3DSA:3.30.50.104.5E-9150180IPR013088Zinc finger, NHR/GATA-type
PfamPF003202.5E-10151181IPR000679Zinc finger, GATA-type
SMARTSM004010.0024151184IPR000679Zinc finger, GATA-type
SMARTSM004010.016185236IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.1E-6187222IPR013088Zinc finger, NHR/GATA-type
PfamPF003207.6E-9189222IPR000679Zinc finger, GATA-type
SMARTSM004010.014259321IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.57E-7264310No hitNo description
Gene3DG3DSA:3.30.50.103.7E-6264292IPR013088Zinc finger, NHR/GATA-type
PfamPF003205.8E-9264294IPR000679Zinc finger, GATA-type
SMARTSM004013.1E-5334389IPR000679Zinc finger, GATA-type
PROSITE profilePS501148.972338365IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.104.9E-8338369IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577167.6E-6338395No hitNo description
PfamPF003204.2E-8340369IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MESLESFDEL LDFPSDVGEE DKDEDFEASN ALPGDDPSCQ FSETEECSEE VLEWLSNKDA  60
FPPVETFFGI DLSFAGIPWE GEQLSTNQSD NSGKDDMTKA ETPMMAKTVG RQCHHCGTRK  120
TSRWQAGPLG PKTLCNACWC WYKSVMIGGK CQHCGTLNTP QWRRVGRDTL CNACAIKLKH  180
RSEILRRKCQ DCETKKSTPQ WREDCPKGKK ALCDACYVRY KSDIIGRKCQ RCGVGKTKPW  240
QNWGEGPLGK NTLCRDQWEK MPACGTGNSL RWRAGPLGTN TLCDNCGLRY KSGRLFHEYR  300
PASLTSFASK LQPKPPRKKK KIQNIETGIG GEAEIRVRKC QQCETEAXPK WRSGPXGLXT  360
LCNACWHRYE ISKKLVTQCC PASSHTFSKK LRSNRHRKLS NVLRKKQEME TGDFPASSPT  420
FPKKLRSNRH QKLSDILXKK QEMEISVEAI ALLGLPCAYT RCKRTQRSTR CKRTQRSTRC  480
TLPPAAKFHV GLIFVGHYDA PPLPLNVIKL FQRLFSWMGG GDELAVG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2774523
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.16e-16GATA transcription factor 1